Lineage for d6tjlb_ (6tjl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927459Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins)
    Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit
  6. 2927466Protein automated matches [395700] (1 species)
    not a true protein
  7. 2927467Species Nostoc sp. [TaxId:103690] [395701] (3 PDB entries)
  8. 2927471Domain d6tjlb_: 6tjl B: [395739]
    automated match to d2bu3a_
    complexed with ca, gsh

Details for d6tjlb_

PDB Entry: 6tjl (more details), 1.87 Å

PDB Description: mature primitive pytochelatin synthase alr0975 from nostoc species bound to glutathione
PDB Compounds: (B:) alr0975 protein

SCOPe Domain Sequences for d6tjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tjlb_ d.3.1.14 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
qtltlspnligfnsnegekllltsrsredffplsmqfvtqvnqaysgvasiimvlnslgi
napetaqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnha
sdtniedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsr
ykyppvwvkttdlwkamntvdsvsqktrgfvfvsktq

SCOPe Domain Coordinates for d6tjlb_:

Click to download the PDB-style file with coordinates for d6tjlb_.
(The format of our PDB-style files is described here.)

Timeline for d6tjlb_: