| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins) Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit |
| Protein automated matches [395700] (1 species) not a true protein |
| Species Nostoc sp. [TaxId:103690] [395701] (3 PDB entries) |
| Domain d6tjlb_: 6tjl B: [395739] automated match to d2bu3a_ complexed with ca, gsh |
PDB Entry: 6tjl (more details), 1.87 Å
SCOPe Domain Sequences for d6tjlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tjlb_ d.3.1.14 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
qtltlspnligfnsnegekllltsrsredffplsmqfvtqvnqaysgvasiimvlnslgi
napetaqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnha
sdtniedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsr
ykyppvwvkttdlwkamntvdsvsqktrgfvfvsktq
Timeline for d6tjlb_: