SCOPe 2.08: Domain d6t5xa_: 6t5x A:

Lineage for d6t5xa_ (6t5x A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [395721] (1 PDB entry)

8. Domain d6t5xa_: 6t5x A: [395722]
   automated match to d3rshb_
   complexed with gol, na, ndp

Details for d6t5xa_

PDB Entry: 6t5x, 1.5 Å

PDB Description: crystal structure of salmonella typhimurium fabg in complex with nadph at 1.5 a resolution

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d6t5xa_:

Sequence; same for both SEQRES and ATOM records:

>d6t5xa_ c.2.1.2 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
sfegkialvtgasrgigraiaetlvargakvigtatsengaknisdylgangkglmlnvt
dpasiesvleniraefgevdilvnnagitrdnllmrmkddewndiietnlssvfrlskav
mrammkkrcgriitigsvvgtmgnagqanyaaakagligfskslarevasrgitvnvvap
gfietdmtralsddqragilaqvpagrlggaqeiasavaflasdeasyitgetlhvnggm
ymv

Timeline for d6t5xa_:

• d6t5xa_ first appeared in SCOPe 2.07