Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Serratia proteamaculans [TaxId:28151] [395713] (5 PDB entries) |
Domain d6tf5a2: 6tf5 A:412-677 [395714] Other proteins in same PDB: d6tf5a1, d6tf5a3 automated match to d3iula2 |
PDB Entry: 6tf5 (more details), 2 Å
SCOPe Domain Sequences for d6tf5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tf5a2 c.69.1.0 (A:412-677) automated matches {Serratia proteamaculans [TaxId: 28151]} enyrservwvkardgvevpvslvyrhdsfargtnplmvygygsygssmdpafsasrlsll drgfvfvlahirgggelgqlwyedgklfkkqntfndfidvtealiaqgygdakrvfamgg saggllmgavinqapelfngivaqvpfvdvvttmldesiplttgeydewgnpnqqayydy ilqyspydqvkaqdyphmlvttglhdsqvqywepakwvaklrelktddrqlllytdmdsg hggksgrfkayedialeyafilalae
Timeline for d6tf5a2: