SCOP 1.75: Domain d1qmhb2: 1qmh B:5-184,B:280-339

Lineage for d1qmhb2 (1qmh B:5-184,B:280-339)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (2 families)

5. Family d.68.2.1: RNA 3'-terminal phosphate cyclase, RPTC [55206] (1 protein)
   duplication: 3 repeats of this fold are packed together around the pseudo threefold axis

6. Protein RNA 3'-terminal phosphate cyclase, RPTC [55207] (1 species)
   also contains an insert alpha+beta domain of the thioredoxin-like topology

7. Species Escherichia coli [TaxId:562] [55208] (2 PDB entries)

8. Domain d1qmhb2: 1qmh B:5-184,B:280-339 [39569]
   Other proteins in same PDB: d1qmha1, d1qmhb1
   CASP3

Details for d1qmhb2

PDB Entry: 1qmh, 2.1 Å

PDB Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology

PDB Compounds: (B:) RNA 3'-terminal phosphate cyclase

SCOP Domain Sequences for d1qmhb2:

Sequence; same for both SEQRES and ATOM records:

>d1qmhb2 d.68.2.1 (B:5-184,B:280-339) RNA 3'-terminal phosphate cyclase, RPTC {Escherichia coli [TaxId: 562]}
mialdgaqgegggqilrsalslsmitgqpftitsiragrakpgllrqhltavkaateicg
atvegaelgsqrllfrpgtvrggdyrfaigsagsctlvlqtvlpalwfadgpsrvevsgg
tdnpsappadfirrvlepllakigihqqttllrhgfypagggvvatevspvasfntlqlg
Xavgeyladqlvlpmalagageftvahpschlltniavverflpvrfslietdgvtrvsi
e

Timeline for d1qmhb2:

• d1qmhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qmhb2 appears in SCOP 1.73
  
• d1qmhb2 appears in SCOPe 2.01
  
• d1qmhb2 appears in the current release, SCOPe 2.08