Lineage for d6lx5a1 (6lx5 A:200-468)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729675Domain d6lx5a1: 6lx5 A:200-468 [395664]
    Other proteins in same PDB: d6lx5a2, d6lx5b2
    automated match to d3kdua_
    complexed with c5f, gol

Details for d6lx5a1

PDB Entry: 6lx5 (more details), 1.87 Å

PDB Description: x-ray structure of human pparalpha ligand binding domain-ciprofibrate co-crystals obtained by delipidation and co-crystallization
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d6lx5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lx5a1 a.123.1.1 (A:200-468) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tadlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklv
angiqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifa
mlssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfv
aaiiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvte
haqlvqiikktesdaalhpllqeiyrdmy

SCOPe Domain Coordinates for d6lx5a1:

Click to download the PDB-style file with coordinates for d6lx5a1.
(The format of our PDB-style files is described here.)

Timeline for d6lx5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lx5a2