Lineage for d1dd5a_ (1dd5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912641Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1912642Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1912643Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1912657Species Thermotoga maritima [TaxId:2336] [55197] (1 PDB entry)
  8. 1912658Domain d1dd5a_: 1dd5 A: [39564]
    complexed with acy

Details for d1dd5a_

PDB Entry: 1dd5 (more details), 2.55 Å

PDB Description: crystal structure of thermotoga maritima ribosome recycling factor, rrf
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1dd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]}
vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
imef

SCOPe Domain Coordinates for d1dd5a_:

Click to download the PDB-style file with coordinates for d1dd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dd5a_: