Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein) |
Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species) |
Species Escherichia coli [TaxId:562] [55189] (5 PDB entries) Uniprot P0A8M3 |
Domain d1qf6a3: 1qf6 A:63-241 [39562] Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a4 protein/RNA complex; complexed with amp, zn |
PDB Entry: 1qf6 (more details), 2.9 Å
SCOPe Domain Sequences for d1qf6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf6a3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]} kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak
Timeline for d1qf6a3: