Lineage for d1qf6a3 (1qf6 A:63-241)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864674Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 864675Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 864676Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)
  6. 864677Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)
  7. 864678Species Escherichia coli [TaxId:562] [55189] (5 PDB entries)
    Uniprot P0A8M3
  8. 864683Domain d1qf6a3: 1qf6 A:63-241 [39562]
    Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a4
    complexed with aet, amp, dhu, g7m, psu, zn

Details for d1qf6a3

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1qf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak

SCOP Domain Coordinates for d1qf6a3:

Click to download the PDB-style file with coordinates for d1qf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a3: