Lineage for d1c05a_ (1c05 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563589Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2563590Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2563591Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2563592Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2563593Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries)
  8. 2563594Domain d1c05a_: 1c05 A: [39559]

Details for d1c05a_

PDB Entry: 1c05 (more details)

PDB Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (minimized average structure)
PDB Compounds: (A:) ribosomal protein s4 delta 41

SCOPe Domain Sequences for d1c05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c05a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

SCOPe Domain Coordinates for d1c05a_:

Click to download the PDB-style file with coordinates for d1c05a_.
(The format of our PDB-style files is described here.)

Timeline for d1c05a_: