Lineage for d1c06a_ (1c06 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33288Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 33289Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 33294Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 33295Protein Ribosomal protein S4 [55179] (2 species)
  7. 33296Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries)
  8. 33297Domain d1c06a_: 1c06 A: [39558]

Details for d1c06a_

PDB Entry: 1c06 (more details)

PDB Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (ensemble of 16 structures)

SCOP Domain Sequences for d1c06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

SCOP Domain Coordinates for d1c06a_:

Click to download the PDB-style file with coordinates for d1c06a_.
(The format of our PDB-style files is described here.)

Timeline for d1c06a_: