Lineage for d6t3va_ (6t3v A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505436Species Psychrobacter sp. [TaxId:408968] [269853] (3 PDB entries)
  8. 2505437Domain d6t3va_: 6t3v A: [395578]
    automated match to d4rkca_
    complexed with lmr, plp

Details for d6t3va_

PDB Entry: 6t3v (more details), 1.62 Å

PDB Description: psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. b6 cocrystalized with substrate analog - malic acid
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d6t3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t3va_ c.67.1.0 (A:) automated matches {Psychrobacter sp. [TaxId: 408968]}
mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd

SCOPe Domain Coordinates for d6t3va_:

Click to download the PDB-style file with coordinates for d6t3va_.
(The format of our PDB-style files is described here.)

Timeline for d6t3va_: