Lineage for d5rzea2 (5rze A:191-296)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697553Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries)
  8. 2697572Domain d5rzea2: 5rze A:191-296 [395570]
    Other proteins in same PDB: d5rzea1, d5rzea3
    automated match to d2he7a2
    complexed with dms, edo, ryp

Details for d5rzea2

PDB Entry: 5rze (more details), 1.69 Å

PDB Description: epb41l3 pandda analysis group deposition -- crystal structure of the ferm domain of human epb41l3 in complex with z2856434786
PDB Compounds: (A:) Isoform 2 of Band 4.1-like protein 3

SCOPe Domain Sequences for d5rzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rzea2 a.11.2.0 (A:191-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpaqlseditryylclqlrddivsgrlpcsfvtlallgsytvqselgdydpdecgsdyi
sefrfapnhtkeledkvielhkshrgmtpaeaemhflenakklsmy

SCOPe Domain Coordinates for d5rzea2:

Click to download the PDB-style file with coordinates for d5rzea2.
(The format of our PDB-style files is described here.)

Timeline for d5rzea2: