Lineage for d5rzxa3 (5rzx A:297-390)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803823Domain d5rzxa3: 5rzx A:297-390 [395568]
    Other proteins in same PDB: d5rzxa1, d5rzxa2
    automated match to d2he7a3
    complexed with dms, edo, o0y

Details for d5rzxa3

PDB Entry: 5rzx (more details), 1.74 Å

PDB Description: epb41l3 pandda analysis group deposition -- crystal structure of the ferm domain of human epb41l3 in complex with z2856434814
PDB Compounds: (A:) Isoform 2 of Band 4.1-like protein 3

SCOPe Domain Sequences for d5rzxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rzxa3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgef
eqfestigfklpnhraakrlwkvcvehhtffrll

SCOPe Domain Coordinates for d5rzxa3:

Click to download the PDB-style file with coordinates for d5rzxa3.
(The format of our PDB-style files is described here.)

Timeline for d5rzxa3: