Lineage for d1hr0d_ (1hr0 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912489Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1912490Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1912491Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1912492Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1912523Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1912537Domain d1hr0d_: 1hr0 D: [39554]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0d_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1hr0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOPe Domain Coordinates for d1hr0d_:

Click to download the PDB-style file with coordinates for d1hr0d_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0d_: