![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) ![]() |
![]() | Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) |
![]() | Protein Ribosomal protein S4 [55179] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55180] (6 PDB entries) |
![]() | Domain d1hr0d_: 1hr0 D: [39554] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvqenlviefysr
Timeline for d1hr0d_: