| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) ![]() possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
| Family d.15.10.1: TGS domain [81270] (1 protein) automatically mapped to Pfam PF02824 |
| Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species) |
| Species Escherichia coli [TaxId:562] [55177] (5 PDB entries) Uniprot P0A8M3 |
| Domain d1qf6a2: 1qf6 A:2-62 [39551] Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4 protein/RNA complex; complexed with amp, zn |
PDB Entry: 1qf6 (more details), 2.9 Å
SCOPe Domain Sequences for d1qf6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf6a2 d.15.10.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
a
Timeline for d1qf6a2: