SCOPe 2.04: Domain d1qf6a2: 1qf6 A:2-62

Lineage for d1qf6a2 (1qf6 A:2-62)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.1: TGS domain [81270] (1 protein)
   automatically mapped to Pfam PF02824

6. Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)

7. Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)
   Uniprot P0A8M3

8. Domain d1qf6a2: 1qf6 A:2-62 [39551]
   Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4
   protein/RNA complex; complexed with amp, zn

Details for d1qf6a2

PDB Entry: 1qf6, 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1qf6a2:

Sequence; same for both SEQRES and ATOM records:

>d1qf6a2 d.15.10.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
a

Timeline for d1qf6a2:

• d1qf6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qf6a2 appears in SCOPe 2.03
  
• d1qf6a2 appears in SCOPe 2.05
  
• d1qf6a2 appears in the current release, SCOPe 2.08