Lineage for d1qf6a2 (1qf6 A:2-62)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854861Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 854862Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 854863Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 854864Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)
    Uniprot P0A8M3
  8. 854869Domain d1qf6a2: 1qf6 A:2-62 [39551]
    Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4
    complexed with aet, amp, dhu, g7m, psu, zn

Details for d1qf6a2

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1qf6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a2 d.15.10.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
a

SCOP Domain Coordinates for d1qf6a2:

Click to download the PDB-style file with coordinates for d1qf6a2.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a2: