SCOP 1.71: Domain d1qf6a2: 1qf6 A:2-62

Lineage for d1qf6a2 (1qf6 A:2-62)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (2 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.1: TGS domain [81270] (1 protein)

6. Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)

7. Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)

8. Domain d1qf6a2: 1qf6 A:2-62 [39551]
   Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4
   complexed with aet, amp, dhu, g7m, psu, zn

Details for d1qf6a2

PDB Entry: 1qf6, 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a2:

Sequence; same for both SEQRES and ATOM records:

>d1qf6a2 d.15.10.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli}
pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
a

Timeline for d1qf6a2:

• d1qf6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qf6a2 appears in SCOP 1.69
  
• d1qf6a2 appears in SCOP 1.73
  
• d1qf6a2 appears in the current release, SCOPe 2.08