Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (2 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.1: TGS domain [81270] (1 protein) |
Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species) |
Species Escherichia coli [TaxId:562] [55177] (1 PDB entry) |
Domain d1qf6a2: 1qf6 A:2-62 [39551] Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4 complexed with aet, amp, dhu, g7m, psu, zn |
PDB Entry: 1qf6 (more details), 2.9 Å
SCOP Domain Sequences for d1qf6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf6a2 d.15.10.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli} pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit a
Timeline for d1qf6a2: