Lineage for d1qf6a2 (1qf6 A:2-62)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33288Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 33289Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 33290Family d.66.1.1: Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55175] (1 protein)
  6. 33291Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (1 species)
  7. 33292Species Escherichia coli [TaxId:562] [55177] (1 PDB entry)
  8. 33293Domain d1qf6a2: 1qf6 A:2-62 [39551]
    Other proteins in same PDB: d1qf6a1, d1qf6a3, d1qf6a4

Details for d1qf6a2

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a2 d.66.1.1 (A:2-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli}
pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
a

SCOP Domain Coordinates for d1qf6a2:

Click to download the PDB-style file with coordinates for d1qf6a2.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a2: