![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) ![]() zinc-binding motif |
![]() | Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (1 protein) |
![]() | Protein Sonic hedgehog [55171] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [55172] (1 PDB entry) |
![]() | Domain d1vhh__: 1vhh - [39550] complexed with so4, zn |
PDB Entry: 1vhh (more details), 1.7 Å
SCOP Domain Sequences for d1vhh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhh__ d.65.1.2 (-) Sonic hedgehog {Mouse (Mus musculus)} kltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrl mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk ygmlarlaveagfdwvyyeskahihcsvkaensvaak
Timeline for d1vhh__: