Lineage for d1vhh__ (1vhh -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605354Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 605355Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) (S)
    zinc-binding motif
  5. 605360Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (1 protein)
  6. 605361Protein Sonic hedgehog [55171] (1 species)
  7. 605362Species Mouse (Mus musculus) [TaxId:10090] [55172] (1 PDB entry)
  8. 605363Domain d1vhh__: 1vhh - [39550]
    complexed with so4, zn

Details for d1vhh__

PDB Entry: 1vhh (more details), 1.7 Å

PDB Description: a potential catalytic site within the amino-terminal signalling domain of sonic hedgehog

SCOP Domain Sequences for d1vhh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhh__ d.65.1.2 (-) Sonic hedgehog {Mouse (Mus musculus)}
kltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrl
mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk
ygmlarlaveagfdwvyyeskahihcsvkaensvaak

SCOP Domain Coordinates for d1vhh__:

Click to download the PDB-style file with coordinates for d1vhh__.
(The format of our PDB-style files is described here.)

Timeline for d1vhh__: