Lineage for d1vhh__ (1vhh -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.65: Hedgehog/DD-pepidase [55165] (1 superfamily) Superfamily d.65.1: Hedgehog/DD-pepidase [55166] (2 families) 
Family d.65.1.2: Hedgehog (development protein), N-terminal signalling domain [55170] (1 protein) Protein Sonic hedgehog [55171] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [55172] (1 PDB entry) 
Domain d1vhh__: 1vhh - [39550]
Details for d1vhh__
PDB Entry: 1vhh (more details), 1.7 Å
PDB Description: a potential catalytic site within the amino-terminal signalling domain of sonic hedgehog
SCOP Domain Sequences for d1vhh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhh__ d.65.1.2 (-) Sonic hedgehog {Mouse (Mus musculus)}
kltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrl
mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk
ygmlarlaveagfdwvyyeskahihcsvkaensvaak
SCOP Domain Coordinates for d1vhh__:
Click to download the PDB-style file with coordinates for d1vhh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhh__:
- d1vhh__ appears in SCOP 1.57
- d1vhh__ appears in the current release, SCOPe 2.08, called d1vhha_
View in 3D