Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d5rzia1: 5rzi A:107-190 [395491] Other proteins in same PDB: d5rzia2, d5rzia3 automated match to d2he7a1 complexed with dms, edo, whs |
PDB Entry: 5rzi (more details), 2.09 Å
SCOPe Domain Sequences for d5rzia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rzia1 d.15.1.0 (A:107-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} pksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwld pakeikkqvrsgawhfsfnvkfyp
Timeline for d5rzia1: