SCOPe 2.08: Domain d6rmub_: 6rmu B:

Lineage for d6rmub_ (6rmu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)

8. Domain d6rmub_: 6rmu B: [395433]
   automated match to d3rj3b_
   complexed with edo, peg

Details for d6rmub_

PDB Entry: 6rmu, 2.4 Å

PDB Description: crystal structure of disulphide-linked human c3d dimer in complex with staphylococcus aureus complement subversion protein sbi-iv

PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d6rmub_:

Sequence; same for both SEQRES and ATOM records:

>d6rmub_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgcgeqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapdhqeln

Timeline for d6rmub_:

• d6rmub_ first appeared in SCOPe 2.07