Lineage for d1d8ib_ (1d8i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956671Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2956672Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2956673Family d.63.1.1: mRNA triphosphatase CET1 [55155] (2 proteins)
    Pfam PF02940
  6. 2956674Protein mRNA triphosphatase CET1 [55156] (1 species)
  7. 2956675Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55157] (2 PDB entries)
  8. 2956677Domain d1d8ib_: 1d8i B: [39542]
    protein/RNA complex; complexed with so4

Details for d1d8ib_

PDB Entry: 1d8i (more details), 2.05 Å

PDB Description: x-ray crystal structure of yeast rna triphosphatase in complex with a sulfate ion.
PDB Compounds: (B:) mRNA triphosphatase cet1

SCOPe Domain Sequences for d1d8ib_:

Sequence, based on SEQRES records: (download)

>d1d8ib_ d.63.1.1 (B:) mRNA triphosphatase CET1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
y

Sequence, based on observed residues (ATOM records): (download)

>d1d8ib_ d.63.1.1 (B:) mRNA triphosphatase CET1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy

SCOPe Domain Coordinates for d1d8ib_:

Click to download the PDB-style file with coordinates for d1d8ib_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ib_: