SCOPe 2.08: Domain d6p26a_: 6p26 A:

Lineage for d6p26a_ (6p26 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [395398] (2 PDB entries)

8. Domain d6p26a_: 6p26 A: [395414]
   Other proteins in same PDB: d6p26c1
   automated match to d1jjca_
   protein/RNA complex; complexed with no4

Details for d6p26a_

PDB Entry: 6p26, 3.16 Å

PDB Description: escherichia coli trna synthetase in complex with compound 1

PDB Compounds: (A:) Phenylalanine--tRNA ligase alpha subunit

SCOPe Domain Sequences for d6p26a_:

Sequence; same for both SEQRES and ATOM records:

>d6p26a_ d.104.1.0 (A:) automated matches {Escherichia coli [TaxId: 511145]}
laaetidvslpgrriengglhpvtrtidriesffgelgftvatgpeieddyhnfdalnip
ghhparadhdtfwfdttrllrtqtsgvqirtmkaqqppiriiapgrvyrndydqthtpmf
hqmeglivdtnisftnlkgtlhdflrnffeedlqirfrpsyfpftepsaevdvmgkngkw
levlgcgmvhpnvlrnvgidpevysgfafgmgmerltmlrygvtdlrsffendlrflkqf
k

Timeline for d6p26a_:

• d6p26a_ first appeared in SCOPe 2.07