Lineage for d1f34b_ (1f34 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912303Fold d.62: Pepsin inhibitor-3 [55148] (1 superfamily)
    duplication of beta(3)-alpha(2) motif: meander beta sheets form barrel-like structure
  4. 1912304Superfamily d.62.1: Pepsin inhibitor-3 [55149] (1 family) (S)
  5. 1912305Family d.62.1.1: Pepsin inhibitor-3 [55150] (1 protein)
  6. 1912306Protein Pepsin inhibitor-3 [55151] (1 species)
  7. 1912307Species Pig roundworm (Ascaris suum) [TaxId:6253] [55152] (2 PDB entries)
  8. 1912309Domain d1f34b_: 1f34 B: [39540]
    Other proteins in same PDB: d1f34a_
    complexed with mpd

Details for d1f34b_

PDB Entry: 1f34 (more details), 2.45 Å

PDB Description: crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin
PDB Compounds: (B:) major pepsin inhibitor pi-3

SCOPe Domain Sequences for d1f34b_:

Sequence, based on SEQRES records: (download)

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppssgmphgavpagglspppppsfctv

Sequence, based on observed residues (ATOM records): (download)

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppagglspppppsfctv

SCOPe Domain Coordinates for d1f34b_:

Click to download the PDB-style file with coordinates for d1f34b_.
(The format of our PDB-style files is described here.)

Timeline for d1f34b_: