Lineage for d1f34b_ (1f34 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33251Fold d.62: Pepsin inhibitor-3 [55148] (1 superfamily)
  4. 33252Superfamily d.62.1: Pepsin inhibitor-3 [55149] (1 family) (S)
  5. 33253Family d.62.1.1: Pepsin inhibitor-3 [55150] (1 protein)
  6. 33254Protein Pepsin inhibitor-3 [55151] (1 species)
  7. 33255Species Pig roundworm (Ascaris suum) [TaxId:6253] [55152] (2 PDB entries)
  8. 33257Domain d1f34b_: 1f34 B: [39540]
    Other proteins in same PDB: d1f34a_

Details for d1f34b_

PDB Entry: 1f34 (more details), 2.45 Å

PDB Description: crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin

SCOP Domain Sequences for d1f34b_:

Sequence, based on SEQRES records: (download)

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum)}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppssgmphgavpagglspppppsfctv

Sequence, based on observed residues (ATOM records): (download)

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum)}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppagglspppppsfctv

SCOP Domain Coordinates for d1f34b_:

Click to download the PDB-style file with coordinates for d1f34b_.
(The format of our PDB-style files is described here.)

Timeline for d1f34b_: