SCOPe 2.08: Domain d1f34b_: 1f34 B:

Lineage for d1f34b_ (1f34 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.62: Pepsin inhibitor-3 [55148] (1 superfamily)
   duplication of beta(3)-alpha(2) motif: meander beta sheets form barrel-like structure

4. Superfamily d.62.1: Pepsin inhibitor-3 [55149] (1 family)

5. Family d.62.1.1: Pepsin inhibitor-3 [55150] (1 protein)

6. Protein Pepsin inhibitor-3 [55151] (1 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [55152] (2 PDB entries)

8. Domain d1f34b_: 1f34 B: [39540]
   Other proteins in same PDB: d1f34a_
   complexed with mpd

Details for d1f34b_

PDB Entry: 1f34, 2.45 Å

PDB Description: crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin

PDB Compounds: (B:) major pepsin inhibitor pi-3

SCOPe Domain Sequences for d1f34b_:

Sequence, based on SEQRES records:

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppssgmphgavpagglspppppsfctv

Sequence, based on observed residues (ATOM records):

>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
qppagglspppppsfctv

Timeline for d1f34b_:

• d1f34b_ first appeared (with stable ids) in SCOP 1.55
  
• d1f34b_ appears in SCOPe 2.07