![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.62: Pepsin inhibitor-3 [55148] (1 superfamily) duplication of beta(3)-alpha(2) motif: meander beta sheets form barrel-like structure |
![]() | Superfamily d.62.1: Pepsin inhibitor-3 [55149] (1 family) ![]() |
![]() | Family d.62.1.1: Pepsin inhibitor-3 [55150] (1 protein) |
![]() | Protein Pepsin inhibitor-3 [55151] (1 species) |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [55152] (2 PDB entries) |
![]() | Domain d1f34b_: 1f34 B: [39540] Other proteins in same PDB: d1f34a_ complexed with mpd |
PDB Entry: 1f34 (more details), 2.45 Å
SCOPe Domain Sequences for d1f34b_:
Sequence, based on SEQRES records: (download)
>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]} qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen qppssgmphgavpagglspppppsfctv
>d1f34b_ d.62.1.1 (B:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]} qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen qppagglspppppsfctv
Timeline for d1f34b_: