![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.2: RNase P protein [54220] (2 proteins) automatically mapped to Pfam PF00825 |
![]() | Protein automated matches [357987] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [357988] (2 PDB entries) |
![]() | Domain d6ov1b1: 6ov1 B:2-115 [395372] Other proteins in same PDB: d6ov1a2, d6ov1b2 automated match to d1d6ta_ mutant |
PDB Entry: 6ov1 (more details), 1.66 Å
SCOPe Domain Sequences for d6ov1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ov1b1 d.14.1.2 (B:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]} ekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkik rairenfkvhkshilakdiiviarqaakdmttlqiqnslehvlkiakvfnkkik
Timeline for d6ov1b1: