Lineage for d6ov1b1 (6ov1 B:2-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930242Family d.14.1.2: RNase P protein [54220] (2 proteins)
    automatically mapped to Pfam PF00825
  6. 2930253Protein automated matches [357987] (2 species)
    not a true protein
  7. 2930254Species Staphylococcus aureus [TaxId:1280] [357988] (2 PDB entries)
  8. 2930256Domain d6ov1b1: 6ov1 B:2-115 [395372]
    Other proteins in same PDB: d6ov1a2, d6ov1b2
    automated match to d1d6ta_
    mutant

Details for d6ov1b1

PDB Entry: 6ov1 (more details), 1.66 Å

PDB Description: structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity
PDB Compounds: (B:) Ribonuclease P protein component

SCOPe Domain Sequences for d6ov1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ov1b1 d.14.1.2 (B:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
ekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkik
rairenfkvhkshilakdiiviarqaakdmttlqiqnslehvlkiakvfnkkik

SCOPe Domain Coordinates for d6ov1b1:

Click to download the PDB-style file with coordinates for d6ov1b1.
(The format of our PDB-style files is described here.)

Timeline for d6ov1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ov1b2