Lineage for d6lp0a_ (6lp0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 3000352Family d.165.1.0: automated matches [191615] (1 protein)
    not a true family
  6. 3000353Protein automated matches [191124] (8 species)
    not a true protein
  7. 3000354Species Bitter gourd (Momordica charantia) [TaxId:3673] [312311] (16 PDB entries)
  8. 3000361Domain d6lp0a_: 6lp0 A: [395335]
    automated match to d1cf5a_
    protein/RNA complex; complexed with amp, nag

Details for d6lp0a_

PDB Entry: 6lp0 (more details), 1.52 Å

PDB Description: crystal structure of alpha-momorcharin in complex with amp
PDB Compounds: (A:) Ribosome-inactivating protein momordin I

SCOPe Domain Sequences for d6lp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lp0a_ d.165.1.0 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrn

SCOPe Domain Coordinates for d6lp0a_:

Click to download the PDB-style file with coordinates for d6lp0a_.
(The format of our PDB-style files is described here.)

Timeline for d6lp0a_: