Lineage for d1d5yb3 (1d5y B:122-294)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33227Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
  4. 33228Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (2 families) (S)
  5. 33236Family d.60.1.2: Rob transcription factor, C-terminal domain [55140] (1 protein)
  6. 33237Protein Rob transcription factor, C-terminal domain [55141] (1 species)
  7. 33238Species Escherichia coli [TaxId:562] [55142] (1 PDB entry)
  8. 33240Domain d1d5yb3: 1d5y B:122-294 [39533]
    Other proteins in same PDB: d1d5ya1, d1d5ya2, d1d5yb1, d1d5yb2, d1d5yc1, d1d5yc2, d1d5yd1, d1d5yd2

Details for d1d5yb3

PDB Entry: 1d5y (more details), 2.7 Å

PDB Description: crystal structure of the e. coli rob transcription factor in complex with dna

SCOP Domain Sequences for d1d5yb3:

Sequence, based on SEQRES records: (download)

>d1d5yb3 d.60.1.2 (B:122-294) Rob transcription factor, C-terminal domain {Escherichia coli}
eftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygl
netrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefil
tvygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirrklaaa

Sequence, based on observed residues (ATOM records): (download)

>d1d5yb3 d.60.1.2 (B:122-294) Rob transcription factor, C-terminal domain {Escherichia coli}
eftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygl
netrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefil
tvygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirrklaaa

SCOP Domain Coordinates for d1d5yb3:

Click to download the PDB-style file with coordinates for d1d5yb3.
(The format of our PDB-style files is described here.)

Timeline for d1d5yb3: