Lineage for d1d5yb3 (1d5y B:122-289)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956515Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2956516Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2956532Family d.60.1.2: Rob transcription factor, C-terminal domain [55140] (1 protein)
    automatically mapped to Pfam PF06445
  6. 2956533Protein Rob transcription factor, C-terminal domain [55141] (1 species)
  7. 2956534Species Escherichia coli [TaxId:562] [55142] (1 PDB entry)
  8. 2956536Domain d1d5yb3: 1d5y B:122-289 [39533]
    Other proteins in same PDB: d1d5ya1, d1d5ya2, d1d5ya4, d1d5yb1, d1d5yb2, d1d5yb4, d1d5yc1, d1d5yc2, d1d5yc4, d1d5yd1, d1d5yd2, d1d5yd4
    protein/DNA complex

Details for d1d5yb3

PDB Entry: 1d5y (more details), 2.7 Å

PDB Description: crystal structure of the e. coli rob transcription factor in complex with dna
PDB Compounds: (B:) rob transcription factor

SCOPe Domain Sequences for d1d5yb3:

Sequence, based on SEQRES records: (download)

>d1d5yb3 d.60.1.2 (B:122-289) Rob transcription factor, C-terminal domain {Escherichia coli [TaxId: 562]}
eftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygl
netrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefil
tvygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirr

Sequence, based on observed residues (ATOM records): (download)

>d1d5yb3 d.60.1.2 (B:122-289) Rob transcription factor, C-terminal domain {Escherichia coli [TaxId: 562]}
eftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygl
netrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefil
tvygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirr

SCOPe Domain Coordinates for d1d5yb3:

Click to download the PDB-style file with coordinates for d1d5yb3.
(The format of our PDB-style files is described here.)

Timeline for d1d5yb3: