SCOPe 2.08: Domain d6lgqd1: 6lgq D:1-121

Lineage for d6lgqd1 (6lgq D:1-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)

8. Domain d6lgqd1: 6lgq D:1-121 [395321]
   Other proteins in same PDB: d6lgqd2
   automated match to d2oqra1

Details for d6lgqd1

PDB Entry: 6lgq, 3 Å

PDB Description: the crystal complex structure of histidine kinase and response regulator

PDB Compounds: (D:) DNA-binding response regulator

SCOPe Domain Sequences for d6lgqd1:

Sequence; same for both SEQRES and ATOM records:

>d6lgqd1 c.23.1.0 (D:1-121) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
a

Timeline for d6lgqd1:

• d6lgqd1 first appeared in SCOPe 2.07