Lineage for d6m64c_ (6m64 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387737Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2387744Protein Smad2 MH2 domain [49883] (1 species)
  7. 2387745Species Human (Homo sapiens) [TaxId:9606] [49884] (4 PDB entries)
  8. 2387747Domain d6m64c_: 6m64 C: [395314]
    Other proteins in same PDB: d6m64a2
    automated match to d1khxa_

Details for d6m64c_

PDB Entry: 6m64 (more details), 1.45 Å

PDB Description: crystal structure of smad2 in complex with cbp
PDB Compounds: (C:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d6m64c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m64c_ b.26.1.1 (C:) Smad2 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
tysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatve
mtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifn
nqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngpl
qwldkvltqmgsps

SCOPe Domain Coordinates for d6m64c_:

Click to download the PDB-style file with coordinates for d6m64c_.
(The format of our PDB-style files is described here.)

Timeline for d6m64c_: