Class b: All beta proteins [48724] (178 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.1: SMAD domain [49880] (5 proteins) |
Protein Smad2 MH2 domain [49883] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49884] (4 PDB entries) |
Domain d6m64c_: 6m64 C: [395314] Other proteins in same PDB: d6m64a2 automated match to d1khxa_ |
PDB Entry: 6m64 (more details), 1.45 Å
SCOPe Domain Sequences for d6m64c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m64c_ b.26.1.1 (C:) Smad2 MH2 domain {Human (Homo sapiens) [TaxId: 9606]} tysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatve mtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifn nqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngpl qwldkvltqmgsps
Timeline for d6m64c_: