Lineage for d1exia2 (1exi A:121-277)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563243Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2563244Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2563245Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins)
    automatically mapped to Pfam PF06445
  6. 2563246Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 2563247Species Bacillus subtilis [TaxId:1423] [55139] (6 PDB entries)
    Uniprot P39075
  8. 2563253Domain d1exia2: 1exi A:121-277 [39531]
    Other proteins in same PDB: d1exia1
    protein/DNA complex; complexed with 118, zn

Details for d1exia2

PDB Entry: 1exi (more details), 3.12 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1exia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exia2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiria

SCOPe Domain Coordinates for d1exia2:

Click to download the PDB-style file with coordinates for d1exia2.
(The format of our PDB-style files is described here.)

Timeline for d1exia2: