Lineage for d1exia2 (1exi A:121-277)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33227Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
  4. 33228Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (2 families) (S)
  5. 33229Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (1 protein)
  6. 33230Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 33231Species Bacillus subtilis [TaxId:1423] [55139] (4 PDB entries)
  8. 33235Domain d1exia2: 1exi A:121-277 [39531]
    Other proteins in same PDB: d1exia1

Details for d1exia2

PDB Entry: 1exi (more details), 3.12 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb

SCOP Domain Sequences for d1exia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exia2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiria

SCOP Domain Coordinates for d1exia2:

Click to download the PDB-style file with coordinates for d1exia2.
(The format of our PDB-style files is described here.)

Timeline for d1exia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exia1