Lineage for d1exja2 (1exj A:121-277)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413480Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 413481Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (3 families) (S)
  5. 413482Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (1 protein)
  6. 413483Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 413484Species Bacillus subtilis [TaxId:1423] [55139] (4 PDB entries)
  8. 413487Domain d1exja2: 1exj A:121-277 [39530]
    Other proteins in same PDB: d1exja1
    protein/DNA complex; complexed with 119, na, zn

Details for d1exja2

PDB Entry: 1exj (more details), 3 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp

SCOP Domain Sequences for d1exja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exja2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiria

SCOP Domain Coordinates for d1exja2:

Click to download the PDB-style file with coordinates for d1exja2.
(The format of our PDB-style files is described here.)

Timeline for d1exja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exja1