SCOPe 2.08: Domain d6llxa2: 6llx A:79-209

Lineage for d6llxa2 (6llx A:79-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d6llxa2: 6llx A:79-209 [395291]
   Other proteins in same PDB: d6llxa1, d6llxb1, d6llxb3
   automated match to d5djma2
   complexed with gsh, mes

Details for d6llxa2

PDB Entry: 6llx, 1.58 Å

PDB Description: discovery of a dual inhibitor of nqo1 and gstp1 for treating malignant glioblastoma

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d6llxa2:

Sequence; same for both SEQRES and ATOM records:

>d6llxa2 a.45.1.1 (A:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

Timeline for d6llxa2:

• d6llxa2 first appeared in SCOPe 2.07