Lineage for d2bowa_ (2bow A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605274Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 605275Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (3 families) (S)
  5. 605276Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (1 protein)
  6. 605277Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 605278Species Bacillus subtilis [TaxId:1423] [55139] (5 PDB entries)
  8. 605281Domain d2bowa_: 2bow A: [39529]
    complexed with mn, p4p, so4

Details for d2bowa_

PDB Entry: 2bow (more details), 2.8 Å

PDB Description: multidrug-binding domain of transcription activator bmrr in complex with a ligand, tetraphenylphosphonium

SCOP Domain Sequences for d2bowa_:

Sequence, based on SEQRES records: (download)

>d2bowa_ d.60.1.1 (A:) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiril

Sequence, based on observed residues (ATOM records): (download)

>d2bowa_ d.60.1.1 (A:) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysygatfsfqpytsidemtyrhiftpvlt
issitpdmeittipkgryaciaynfspehyflnlqklikyiadrqltvvsdvyeliipih
yrvemkiril

SCOP Domain Coordinates for d2bowa_:

Click to download the PDB-style file with coordinates for d2bowa_.
(The format of our PDB-style files is described here.)

Timeline for d2bowa_: