SCOP 1.71: Domain d2bowa_: 2bow A:

Lineage for d2bowa_ (2bow A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
   duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)

4. Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (3 families)

5. Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (1 protein)

6. Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55139] (5 PDB entries)

8. Domain d2bowa_: 2bow A: [39529]
   complexed with mn, p4p, so4

Details for d2bowa_

PDB Entry: 2bow, 2.8 Å

PDB Description: multidrug-binding domain of transcription activator bmrr in complex with a ligand, tetraphenylphosphonium

SCOP Domain Sequences for d2bowa_:

Sequence, based on SEQRES records:

>d2bowa_ d.60.1.1 (A:) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiril

Sequence, based on observed residues (ATOM records):

>d2bowa_ d.60.1.1 (A:) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis}
lgevfvldeeeiriiqteaegigpenvlnasysygatfsfqpytsidemtyrhiftpvlt
issitpdmeittipkgryaciaynfspehyflnlqklikyiadrqltvvsdvyeliipih
yrvemkiril

Timeline for d2bowa_:

• d2bowa_ first appeared (with stable ids) in SCOP 1.55
  
• d2bowa_ appears in SCOP 1.69
  
• d2bowa_ appears in SCOP 1.73
  
• d2bowa_ appears in the current release, SCOPe 2.08, called d2bowa1