| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
| Domain d6lhfg_: 6lhf G: [395285] Other proteins in same PDB: d6lhfa1, d6lhfd1 automated match to d5eb9a_ |
PDB Entry: 6lhf (more details), 2.7 Å
SCOPe Domain Sequences for d6lhfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lhfg_ b.1.1.0 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tmearflnrnmkhpqegqplelecmpfnidngvswirqdkdgklhfivyisplsrtafpr
nertssqfegskqgssfrlvvknfraqdqgtyfcianinqmlyfssgqpaff
Timeline for d6lhfg_: