| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Penaeus japonicus [TaxId:27405] [379454] (15 PDB entries) |
| Domain d6lrva_: 6lrv A: [395284] automated match to d3a9qe_ mutant |
PDB Entry: 6lrv (more details), 2.3 Å
SCOPe Domain Sequences for d6lrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lrva_ a.25.1.0 (A:) automated matches {Penaeus japonicus [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragphglgeymfdkeln
Timeline for d6lrva_: