SCOP 1.73: Domain d1bxyb_: 1bxy B:

Lineage for d1bxyb_ (1bxy B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (1 species)
   short-chain member of the family

7. Species Thermus thermophilus [TaxId:274] [55132] (5 PDB entries)

8. Domain d1bxyb_: 1bxy B: [39526]

Details for d1bxyb_

PDB Entry: 1bxy, 1.9 Å

PDB Description: crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.

PDB Compounds: (B:) protein (ribosomal protein l30)

SCOP Domain Sequences for d1bxyb_:

Sequence; same for both SEQRES and ATOM records:

>d1bxyb_ d.59.1.1 (B:) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d1bxyb_:

• d1bxyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxyb_ appears in SCOP 1.71
  
• d1bxyb_ appears in SCOP 1.75
  
• d1bxyb_ appears in the current release, SCOPe 2.08