SCOP 1.55: Domain d1bxyb_: 1bxy B:

Lineage for d1bxyb_ (1bxy B:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55132] (1 PDB entry)

8. Domain d1bxyb_: 1bxy B: [39526]

Details for d1bxyb_

PDB Entry: 1bxy, 1.9 Å

PDB Description: crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.

SCOP Domain Sequences for d1bxyb_:

Sequence; same for both SEQRES and ATOM records:

>d1bxyb_ d.59.1.1 (B:) Prokaryotic ribosomal protein L30 {Thermus thermophilus}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d1bxyb_:

• d1bxyb_ appears in SCOP 1.57
  
• d1bxyb_ appears in the current release, SCOPe 2.08