SCOPe 2.08: Domain d6lcaa_: 6lca A:

Lineage for d6lcaa_ (6lca A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)

8. Domain d6lcaa_: 6lca A: [395253]
   automated match to d3fy5a_
   complexed with so4

Details for d6lcaa_

PDB Entry: 6lca, 2.4 Å

PDB Description: crystal structure of human dishevelled1 pdz domain homotrimer

PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d6lcaa_:

Sequence, based on SEQRES records:

>d6lcaa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nivtvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndv
nfenmsnddavrvlreivsqtgpisltvaka

Sequence, based on observed residues (ATOM records):

>d6lcaa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nivtvtlnmerhhflgisivgqsdgiyigsimkggavaadgriepgdmllqvndvnfenm
snddavrvlreivsqtgpisltvaka

Timeline for d6lcaa_:

• d6lcaa_ first appeared in SCOPe 2.07