Lineage for d1bxya_ (1bxy A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864307Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 864308Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 864309Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 864352Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 864390Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 864391Domain d1bxya_: 1bxy A: [39525]

Details for d1bxya_

PDB Entry: 1bxy (more details), 1.9 Å

PDB Description: crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.
PDB Compounds: (A:) protein (ribosomal protein l30)

SCOP Domain Sequences for d1bxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxya_ d.59.1.1 (A:) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOP Domain Coordinates for d1bxya_:

Click to download the PDB-style file with coordinates for d1bxya_.
(The format of our PDB-style files is described here.)

Timeline for d1bxya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bxyb_