Lineage for d6lh7b_ (6lh7 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) 
Protein automated matches [195197] (6 species)
not a true protein
Species Vibrio cholerae [TaxId:243277] [390552] (2 PDB entries) 
Domain d6lh7b_: 6lh7 B: [395244]
automated match to d4fo7b_
complexed with gol, na, ni
Details for d6lh7b_
PDB Entry: 6lh7 (more details), 1.47 Å
PDB Description: crystal structure of vibrio cholerae methionine aminopeptidase with partially occupied metals
PDB Compounds: (B:) Methionine aminopeptidaseSCOPe Domain Sequences for d6lh7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lh7b_ d.127.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
sikiknaveiekmrvagrlaaevlemiephvkagvtteeldqichkyitevqgaipapln
yhgfpksictsinhivchgipasedtyfgqiqrpavlrdgdilniditvikdgyhgdtsk
mfligdvsiedkrlchvaqeclylalkqvkpgvqlgeigttiekhiktnnknnprfkfsi
vrdycghgigaefheepqvvhyknsdrtvlregmiftiepminagkfgcrlddedswtvy
tadgkksaqwehtilvtatgceiltlrseeslprilnna
SCOPe Domain Coordinates for d6lh7b_:
Click to download the PDB-style file with coordinates for d6lh7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6lh7b_:
- d6lh7b_ first appeared in SCOPe 2.07
View in 3D
