Lineage for d6lhgj_ (6lhg J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754123Domain d6lhgj_: 6lhg J: [395239]
    Other proteins in same PDB: d6lhga1, d6lhga3, d6lhgd1, d6lhgd3
    automated match to d5eb9a_

Details for d6lhgj_

PDB Entry: 6lhg (more details), 2.8 Å

PDB Description: crystal structure of chicken ccd8aa/pbf2*04:01
PDB Compounds: (J:) CD8 alpha chain

SCOPe Domain Sequences for d6lhgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lhgj_ b.1.1.0 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tmearflnrnmkhpqegqplelecmpfnidngvswirqdkdgklhfivyisplsrtafpr
nertssqfegskqgssfrlvvknfraqdqgtyfcianinqmlyfssgqpaff

SCOPe Domain Coordinates for d6lhgj_:

Click to download the PDB-style file with coordinates for d6lhgj_.
(The format of our PDB-style files is described here.)

Timeline for d6lhgj_: