SCOPe 2.07: Domain d6l78c1: 6l78 C:15-235

Lineage for d6l78c1 (6l78 C:15-235)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Aegle marmelos [TaxId:68527] [395033] (6 PDB entries)

8. Domain d6l78c1: 6l78 C:15-235 [395237]
   automated match to d3wd7a1

Details for d6l78c1

PDB Entry: 6l78, 1.55 Å

PDB Description: quinolone synthase (qns) from aegle marmelos

PDB Compounds: (C:) Type III polyketide synthase

SCOPe Domain Sequences for d6l78c1:

Sequence; same for both SEQRES and ATOM records:

>d6l78c1 c.95.1.0 (C:15-235) automated matches {Aegle marmelos [TaxId: 68527]}
glatilaistatppncviqadypdyyfkitnsehmtelkekfrrlceksmirkrhmclte
eilkanpnmclhmgtslnarqdislvevpklgkeaatkaikewgqpkskithlifctsag
vdmpgadyqltrllglspevkrmmiyqqgcyagatvlrlakdltennkgsrvlivcsent
vptfrgpsdthidslvgqalfadgaaalivgadpdasierp

Timeline for d6l78c1:

• d6l78c1 is new in SCOPe 2.07-stable
  
• d6l78c1 appears in the current release, SCOPe 2.08